DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP012492

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_001230278.2 Gene:AgaP_AGAP012492 / 4397588 VectorBaseID:AGAP012492 Length:266 Species:Anopheles gambiae


Alignment Length:246 Identity:68/246 - (27%)
Similarity:103/246 - (41%) Gaps:39/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIG--TVASQYKV 99
            |||:.|....|....:.:|||...        |:.|||||.:.:.:::|.|||..  |..|:..:
Mosquito    23 GRIINGVPVSIEIYKFAVSLRVDN--------RYYCGGSIISVSHVLSAGHCVYPFLTNVSRMSI 79

  Fly   100 VAGTNFQTGSDGVITNVKEIVMHEGYYSG---AAYNNDIAILFVD----------PPLPLNNFTI 151
            ..|:. ...|.|:...|...|.|..|...   ..::.|:|:|.|.          .|:.:.|..|
Mosquito    80 YGGST-SPFSGGISIPVIRAVNHPDYNPNPPFGIHDFDVAVLTVPRNALRGRPNMAPIAIQNVQI 143

  Fly   152 KAIKLALEQPIEGTVSKVSGWGTTSPGGYSS-NQLLAVDVPIVSNELCDQDYEDFGDETYRITSA 215
            .|          ||...|.|||.|.....:: .:|..:::.|||.:.|...|...  ..:.|.|.
Mosquito   144 PA----------GTRCYVVGWGWTDFNARTNPTELHYLNMAIVSQDSCASAYSQV--NIWGINSN 196

  Fly   216 MLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANV 266
            |:||  :|..|.|.|:||||..|.....|.|:.|:.:|....:.|...|.:
Mosquito   197 MICA--KGNQGTDTCKGDSGSALVCGGRLTGISSFTSSMCKTDLPAGLAKL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 67/245 (27%)
Tryp_SPc 39..276 CDD:238113 66/244 (27%)
AgaP_AGAP012492XP_001230278.2 Tryp_SPc 24..246 CDD:214473 67/245 (27%)
Tryp_SPc 25..229 CDD:238113 62/226 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.