DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG34130

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:290 Identity:58/290 - (20%)
Similarity:116/290 - (40%) Gaps:55/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENP 67
            |||.....::|       .|.|.:..|::..:  .|..||:|     ||:.:.:       .:.|
  Fly    22 SSWWNSSASYL-------HGRPPVRTLNKNGI--RRTSGGHA-----VPWLLRI-------VDGP 65

  Fly    68 FRHRCGGSIFNETTIVTAAHCV-----------IGTVASQYKVVAGTNFQTGSDGVITNVKEIVM 121
             ...||.|..:....:|:|:|:           :..|:|..:.....:.....:.:|.|:  ||.
  Fly    66 -TFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDSRQDNQLDSHDPPNALIRNI--IVS 127

  Fly   122 HEGYYSGAAYNNDIAILFVDPPL--PLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQ 184
            .:.::.|...  |:|::.:...|  ..||:....         ...:|........|.|...:..
  Fly   128 KDWHWPGTFM--DVAVIELTNRLRGNRNNYVTLC---------TNPLSSYKSLSVVSYGAGPAEN 181

  Fly   185 LLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVS 249
            :...::.:::..:||..|.:|     .:...:.|| |.....|| |...:|.|:...|:|.|:|:
  Fly   182 VRTEEIEVLNRMICDSAYGNF-----LLRETVACA-KEFKRSAD-CMFSAGCPVTAGDQLCGIVA 239

  Fly   250 WGNSCALPNYPGVYANVAYLRPWIDAVLAG 279
            |..:|...|.||::.::..::.:|...::|
  Fly   240 WSPACKRSNLPGIFTDIHQVKRFILKAISG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 49/247 (20%)
Tryp_SPc 39..276 CDD:238113 49/249 (20%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 46/242 (19%)
Tryp_SPc 53..256 CDD:304450 46/235 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.