DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and intr

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:241 Identity:63/241 - (26%)
Similarity:94/241 - (39%) Gaps:59/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VPYQI-SLRYKGITTPENP--FRH-----------RCGGSIFNETTIVTAAHCVIGTVAS----Q 96
            :|.:| :|...|..|.|.|  .:|           .|.|::.:...::|:|.|...|:..    .
  Fly    77 IPAEIETLLTDGQATTEAPKAVKHFVMRILYENKVICSGALISTRLVLTSALCFPRTLRQPPPRS 141

  Fly    97 YKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPL--PLNNFTIKAIKLALE 159
            ||:.|       |...|.:|..::      :||.  .|:|:|.:..||  |.    :..|.|. |
  Fly   142 YKLQA-------SRSRIYSVANLI------TGAI--EDMALLLLHAPLEDPF----VHPIDLC-E 186

  Fly   160 QPIEGTVSKVSGWGTTSPGGYSSNQ-LLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCA--GK 221
            .|:....:...         |.|.| |..:...::.|..|.:.|..  ||...||..||||  ..
  Fly   187 SPLRRNDNVTM---------YMSQQHLRFLRTKLIPNSNCKRSYAQ--DENAFITQTMLCALNSN 240

  Fly   222 RGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPG-VYANV 266
            |.|.    ||...|..|..:|.|.||..:|..|:.....| :||:|
  Fly   241 RLVD----CQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 63/241 (26%)
Tryp_SPc 39..276 CDD:238113 63/241 (26%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 55/206 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.