DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG4815

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:282 Identity:66/282 - (23%)
Similarity:112/282 - (39%) Gaps:35/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPE 65
            |.|.|.:..|..:::.|....|  ..|:...:..|  ||..|..|.:.      ||...||..  
  Fly     1 MESGWTLVRLLLILNSVRTEAG--NREEWTGRFHP--RIYNGIKTTVE------SLGGVGIQL-- 53

  Fly    66 NPFRHR---CGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGY-- 125
              |..|   |..::.....|:|||||......|::.|:.|.:.:....|...|..:::..:.:  
  Fly    54 --FNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKNKLIRVQIHPK 116

  Fly   126 YSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGY----SSNQLL 186
            |:...:..|:|:.....||.........:..::..|.:..::  :|||  ..||.    ......
  Fly   117 YAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHPRDKLIA--AGWG--FEGGVWDESRKKTFR 177

  Fly   187 AVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWG 251
            ::.|.|||...|::..:      .::...::|||  .......|.|||||||.:..::.|:.:|.
  Fly   178 SMKVGIVSKRDCEKQLD------RKMPPNIICAG--AYNNKTLCFGDSGGPLLLGRQVCGINTWT 234

  Fly   252 NSCALPNYPGVYANVAYLRPWI 273
            ..|.....|.||..|.|...:|
  Fly   235 FKCGNNEKPDVYMGVRYYAKFI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 57/243 (23%)
Tryp_SPc 39..276 CDD:238113 57/244 (23%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 52/224 (23%)
Trypsin 49..256 CDD:278516 51/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.