DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG11836

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:257 Identity:92/257 - (35%)
Similarity:132/257 - (51%) Gaps:43/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAG 102
            |||||..|.:.|.|:...:.|.|        :..||||:..:..:::|||||.....|:.:|:.|
  Fly    96 RIVGGKPTGVNQYPWMARIVYDG--------KFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFG 152

  Fly   103 TNFQ---TGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPI-- 162
            .:.|   :.|..:...|..::.|:. :....||||||:|.:..|:..:    |.||     ||  
  Fly   153 DHDQEITSESQAIQRAVTAVIKHKS-FDPDTYNNDIALLRLRKPISFS----KIIK-----PICL 207

  Fly   163 -------EGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELC-DQDYEDFGDETYRITSAMLCA 219
                   .|.:..|.|||.||.||...:.:..|.|||:|...| :|.|     ::.||||:||||
  Fly   208 PRYNYDPAGRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRY-----KSTRITSSMLCA 267

  Fly   220 GKRGVGGADACQGDSGGPL----AVRDELYGVVSWGNSCALPNYPGVYANVAYLRPWIDAVL 277
            |:..:   |:|||||||||    .|:..:.|:||||..|....|||||:.|:...|||.:.|
  Fly   268 GRPSM---DSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRVSKFIPWIKSNL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 89/251 (35%)
Tryp_SPc 39..276 CDD:238113 90/253 (36%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 90/253 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.