DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG15498

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster


Alignment Length:81 Identity:22/81 - (27%)
Similarity:35/81 - (43%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 FNETTIVTAAHCVI--GTVASQYKVVAGTNFQTGSD-GVITNVKEIVMHEGYYSGAAYNNDIAIL 138
            |.:.|::.....|:  |.|.....|..|...|..|| .::.:|  ::..||.:......|::..|
  Fly    46 FYQGTVLGPPQDVLAFGVVVQIRPVKIGVCRQQVSDQNLVLSV--VITQEGLHRNCKTINEMCDL 108

  Fly   139 FVDP-PLPL--NNFTI 151
            .|.| |.|.  |:|.|
  Fly   109 TVAPSPRPALRNSFRI 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 22/81 (27%)
Tryp_SPc 39..276 CDD:238113 22/81 (27%)
CG15498NP_650974.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.