DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG5255

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:268 Identity:91/268 - (33%)
Similarity:134/268 - (50%) Gaps:22/268 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCG 73
            :|..|:.||..|.. ...:.|........|||||........||||||  :||.:.    .|.||
  Fly     1 MLLILLPLVLFTSS-AASQILYPPQYTKNRIVGGEEAAAGLAPYQISL--QGIGSG----AHSCG 58

  Fly    74 GSIFNETTIVTAAHCVIGTVASQYKVVAGTN--FQTGSDGVITNVKEIVMHEGYYSGAAYNNDIA 136
            |:|.:|..|:|||||..|..|:.::|:.||.  .|.||.....:  .||.|.. |:...|.||||
  Fly    59 GAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPD--RIVEHSN-YAPRKYRNDIA 120

  Fly   137 ILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQD 201
            :|.::..:..:|.| :.::|..|..:.|:...::||||.|.||....:|.:::|..|..|.|...
  Fly   121 LLHLNESIVFDNAT-QPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAA 184

  Fly   202 YEDFGDETYRITSAMLCA-GKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYAN 265
            :    |.:.|:....:|. ..:|.|   ||.|||||||....:|..:|:||..|| ..||..:|:
  Fly   185 H----DNSTRVDIGHVCTFNDKGRG---ACHGDSGGPLVHNGKLVALVNWGLPCA-KGYPDAHAS 241

  Fly   266 VAYLRPWI 273
            ::|...:|
  Fly   242 ISYYHDFI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 84/237 (35%)
Tryp_SPc 39..276 CDD:238113 84/238 (35%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 84/237 (35%)
Tryp_SPc 30..252 CDD:238113 84/238 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.