DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG5246

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:295 Identity:93/295 - (31%)
Similarity:139/295 - (47%) Gaps:67/295 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VALTQGLPLLEDLDEKSV----------------PDGRIVGGYATDIAQVPYQISLRYKGITTPE 65
            :.|...|.:|.....|||                |:.|::||..:.....|||:|:.        
  Fly     4 LVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIM-------- 60

  Fly    66 NPF-RHRCGGSIFNETTIVTAAHCVIGTVASQY-KVVAGTNFQT--GSDGVITNVKEIVMHEGYY 126
            |.| .|.|||||.....|:|||||:...:  || |:|.||...|  |::.::...|....|:   
  Fly    61 NTFGEHVCGGSIIAPQWILTAAHCMEWPI--QYLKIVTGTVDYTRPGAEYLVDGSKIHCSHD--- 120

  Fly   127 SGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKV------SGWGTTSPGGYSSNQL 185
             ..||:||||::....|:..::.| :.||||    .:|::.||      :|||:|...|..|.||
  Fly   121 -KPAYHNDIALIHTAKPIVYDDLT-QPIKLA----SKGSLPKVGDKLTLTGWGSTKTWGRYSTQL 179

  Fly   186 LAVDVPIVSNELCDQDYEDFGDETYRITSA-MLCAG------KRGVGGADACQGDSGGPLA-VRD 242
            ..:|:..:.::.|..          |:.:| .|..|      :.|.|   :|.|||||||. ...
  Fly   180 QKIDLNYIDHDNCQS----------RVRNANWLSEGHVCTFTQEGEG---SCHGDSGGPLVDANQ 231

  Fly   243 ELYGVVSWGNSCALPNYPGVYANVAYLRPWIDAVL 277
            .|.|||:||.:||: .||.|:.:|||...||:.::
  Fly   232 TLVGVVNWGEACAI-GYPDVFGSVAYYHDWIEQMM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 84/252 (33%)
Tryp_SPc 39..276 CDD:238113 85/254 (33%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 84/252 (33%)
Tryp_SPc 42..263 CDD:238113 85/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.