DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG8870

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:264 Identity:72/264 - (27%)
Similarity:105/264 - (39%) Gaps:51/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCV----------IGTVASQYKVVAGT 103
            :.|:...|.|............:||||:.|...::||||||          :.||.     :...
  Fly    94 EFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVR-----LGEH 153

  Fly   104 NFQTGSDGVITN-------------VKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIK 155
            |..|..|..|.|             |.:|:.||.:..|....||||::.:..|:.... .|:.|.
  Fly   154 NTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTR-AIQPIC 217

  Fly   156 LALEQPIEGTVSK--VSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLC 218
            |...|.:.....|  .|||..... |.:|..||...:.....::|..:| ||.      ..:.:|
  Fly   218 LPRAQKLAAHKRKFQASGWPDMGQ-GIASEVLLRSFIAERHPDVCKSNY-DFN------LGSQIC 274

  Fly   219 AGKRGVGGADACQGDSGGPL---AVRDEL-----YGVVSWGNS-CALPN-YPGVYANVAYLRPWI 273
            ||  |:.|.|...|||||||   .:|.::     .|::|:|.. |.|.. .|..|...:|...||
  Fly   275 AG--GLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWI 337

  Fly   274 DAVL 277
            .:.|
  Fly   338 KSKL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 69/258 (27%)
Tryp_SPc 39..276 CDD:238113 71/261 (27%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 71/261 (27%)
Tryp_SPc 93..337 CDD:214473 69/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.