DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG11670

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:263 Identity:69/263 - (26%)
Similarity:106/263 - (40%) Gaps:56/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVI 113
            |.|:..:|   |.....:...::||||:.:|..::|||||:             |...|..|  |
  Fly   180 QYPHMAAL---GFRNENHEIDYKCGGSLISEEFVLTAAHCL-------------TTHGTSPD--I 226

  Fly   114 TNVKEIVMHEGYYSGAAYNNDIAILFVDP--PLPLNNFTIKAIKLALEQPIEGT--VSKVSGW-- 172
            ..:.:|.:.|...:.|.....:|.:::.|  ...||...|..|:  |.:|:|.|  |..|..|  
  Fly   227 VKIGDIKLKEWELNVAPQRRRVAQIYLHPLYNASLNYHDIGLIQ--LNRPVEYTWFVRPVRLWPM 289

  Fly   173 -----GTTSPGGYSS--------NQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGV 224
                 |.....||.|        |.|..:|:.:|..|.|:..........:.:.::.:||... .
  Fly   290 NDIPYGKLHTMGYGSTGFAQPQTNILTELDLSVVPIEQCNSSLPADEGSPHGLLTSQICAHDY-E 353

  Fly   225 GGADACQGDSGGPLAVRDE---------------LYGVVSWGNSCALPNYPGVYANVAYLRPWID 274
            ...|.|||||||||.:..|               |.|:.|:|..|. ...||||..|:....||.
  Fly   354 KNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAYCR-SELPGVYTRVSSYIDWIA 417

  Fly   275 AVL 277
            :::
  Fly   418 SIV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 67/257 (26%)
Tryp_SPc 39..276 CDD:238113 69/260 (27%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 69/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.