DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG16749

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:280 Identity:89/280 - (31%)
Similarity:130/280 - (46%) Gaps:30/280 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSWIVGLLAF-LVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTP 64
            ||.:..:.|..| |::...::.|.|.:          ||:|.|..:.:.:.|:.||:|       
  Fly     1 MSRNQDLCLAVFALLTTAGISHGAPQM----------GRVVNGTDSSVEKYPFVISMR------- 48

  Fly    65 ENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGA 129
            .:...|.|||||.::..::|||||..|..||...|..|......:...:..||:|:.||.|....
  Fly    49 GSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYN 113

  Fly   130 AYNNDIAILFVDPPLPLNNFTIKAIKL-----ALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVD 189
            .|.|||::|.|:.|...:..|:..:||     |..|...|....:.|||..:.|||..:.|..|:
  Fly   114 NYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVE 178

  Fly   190 VPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWG-NS 253
            :.:.|:|.|.:.:....|..|.|     |.|. ..||...|.|||||||....:..|:|||. ..
  Fly   179 LKVYSDEECTERHGGRTDPRYHI-----CGGV-DEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKP 237

  Fly   254 CALPNYPGVYANVAYLRPWI 273
            |.:..|||||..|:....||
  Fly   238 CTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 79/240 (33%)
Tryp_SPc 39..276 CDD:238113 80/241 (33%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 79/240 (33%)
Tryp_SPc 30..259 CDD:238113 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.