DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG12951

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:273 Identity:84/273 - (30%)
Similarity:122/273 - (44%) Gaps:33/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAFLVSLVALTQGLPLLEDLDEKSVPD-GRIVGGYATDIAQVPYQISLR-YKGITTPENPFRHRC 72
            |:.:|.|...|.|         ::.|. .|:|.|..:.:.:.|:.:||| |.|        .|.|
  Fly     9 LSLIVILAVTTVG---------QAAPSISRVVNGTDSSVLKYPFVVSLRSYDG--------SHSC 56

  Fly    73 GGSIFNETTIVTAAHCVIGTVASQYKVVAG-TNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIA 136
            ||||.::..::|||||..|..|....:..| ||.......|: .:|:|:.||.:.......|||:
  Fly    57 GGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISAMGPNVV-GIKKIIQHEDFDPTRQNANDIS 120

  Fly   137 ILFVDPPLPLNNFTIKAIKL-----ALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNE 196
            :|.|:.|...:..::..::|     |:.|...|....:.|||.....|...:.|..|.:.|.|:|
  Fly   121 LLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDE 185

  Fly   197 LCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWG-NSCALPNYP 260
            .|...:....|..|.|     |.|. ..||...|.|||||||....:..|:|||. ..|.:..||
  Fly   186 ECTSRHNGQTDPKYHI-----CGGV-DEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYP 244

  Fly   261 GVYANVAYLRPWI 273
            |||..|:....||
  Fly   245 GVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 76/242 (31%)
Tryp_SPc 39..276 CDD:238113 77/243 (32%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 76/242 (31%)
Tryp_SPc 30..260 CDD:238113 77/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.