DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Try10

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:270 Identity:94/270 - (34%)
Similarity:131/270 - (48%) Gaps:35/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIF 77
            :::||......|        :..|.:|||||......||||:||         |...|.||||:.
  Rat     6 ILALVGAAVAFP--------AADDDKIVGGYTCQENSVPYQVSL---------NSGYHFCGGSLI 53

  Fly    78 NETTIVTAAHCVIGTVASQYKVVAG---TNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILF 139
            ||..:|:||||    ..|:.:|..|   .|...|::..: |..:|:.|..:.. ...||||.::.
  Rat    54 NEQWVVSAAHC----YKSRIQVRLGEHNINVLEGNEQFV-NAAKIIKHPNFIR-KTLNNDIMLIK 112

  Fly   140 VDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLL-AVDVPIVSNELCDQDYE 203
            :..|:.||: .:..:.|.......||...:||||.|...|.:...|| .:|.|::....|:..|.
  Rat   113 LSSPVKLNS-RVATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEASYP 176

  Fly   204 DFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAY 268
            .      :||..|:|||.. .||.|:||||||||:....||.|:||||..||||:.||||..|..
  Rat   177 G------KITDNMVCAGFL-EGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCN 234

  Fly   269 LRPWIDAVLA 278
            ...||...:|
  Rat   235 YVDWIQDTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 87/238 (37%)
Tryp_SPc 39..276 CDD:238113 89/240 (37%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 87/238 (37%)
Tryp_SPc 24..242 CDD:238113 89/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.