DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Klk1c6

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_038942515.1 Gene:Klk1c6 / 408242 RGDID:1303220 Length:262 Species:Rattus norvegicus


Alignment Length:262 Identity:82/262 - (31%)
Similarity:124/262 - (47%) Gaps:37/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVPDG--RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVAS 95
            :.|.|  |:||||..:....|:|:::..:.:          |||.:.:.:.::||||| .....|
  Rat    17 AAPPGQSRVVGGYKCEKNSQPWQVAVISRSL----------CGGVLIDPSWVITAAHC-YSNALS 70

  Fly    96 QYKVVAGTNFQTGSDGVITN---VKEIVMHEGY----------YSGAAYNNDIAILFVDPPLPLN 147
            .|.|:.|.| ....|.....   |.:...|..|          ..|..|:||:.:|.:..|..:.
  Rat    71 YYHVLLGRN-NLSEDEPFAQYRFVSQSFPHPDYNPFFMRNHTRQPGDDYSNDLMLLHLSKPADIT 134

  Fly   148 NFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYS-SNQLLAVDVPIVSNELCDQDYEDFGDETYR 211
            : .:|.|.|..|:|..|:....||||:|.|..:. .:.|..|::.::|||.|.:.|.:      :
  Rat   135 D-GVKVIDLPTEEPKVGSTCLASGWGSTKPLDWELPDDLQCVNIHLLSNEKCIEAYNE------K 192

  Fly   212 ITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNS-CALPNYPGVYANVAYLRPWIDA 275
            :|..|||||.. .||.|.|:|||||||.....|.|:.|||:. ||.||.|.:|..:.....||..
  Rat   193 VTDLMLCAGDL-EGGKDTCKGDSGGPLICDGVLQGITSWGSDPCAEPNMPAIYTKLIKFTSWIKE 256

  Fly   276 VL 277
            |:
  Rat   257 VM 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 77/249 (31%)
Tryp_SPc 39..276 CDD:238113 78/251 (31%)
Klk1c6XP_038942515.1 Tryp_SPc 25..257 CDD:238113 78/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.