DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Tmprss11c

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:249 Identity:93/249 - (37%)
Similarity:128/249 - (51%) Gaps:24/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PDG-RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTV-ASQY 97
            |.| ::.||...:..:.|:|.||:...:        ||||.::.:.:.::|||||.:.:. ...:
  Rat   182 PGGHKVAGGQDAEEGEWPWQASLQQNNV--------HRCGATLISNSWLITAAHCFVRSANPKDW 238

  Fly    98 KVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPP-LPLNNFTIKAIKLALEQP 161
            ||..|  |..........||.||:||. ||..|:|||||::.:..| |..||.....:..|.::.
  Rat   239 KVSFG--FLLSKPQAQRAVKSIVIHEN-YSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKF 300

  Fly   162 IEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGG 226
            ...:...|:||||....|.|.|.|....|.|:.|:.|:.. :.:|..   ||..|||||.. .|.
  Rat   301 PPNSDVVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSG-KAYGGV---ITPGMLCAGFL-EGR 360

  Fly   227 ADACQGDSGGPLAVRDE-----LYGVVSWGNSCALPNYPGVYANVAYLRPWIDA 275
            .|||||||||||...|.     |.|:||||:.|||||.||||..|.:.|.||.:
  Rat   361 VDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWISS 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 89/241 (37%)
Tryp_SPc 39..276 CDD:238113 91/244 (37%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 89/241 (37%)
Tryp_SPc 187..415 CDD:238113 91/244 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.