DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Klk4

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:276 Identity:79/276 - (28%)
Similarity:117/276 - (42%) Gaps:44/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFR 69
            |.:|.|...|:      |       ...|....||:.|........|:|.:|     .:.:|.| 
  Rat    11 WFLGYLILEVT------G-------SSASSISSRIIQGQDCLPHSQPWQAAL-----FSEDNAF- 56

  Fly    70 HRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEI---VMHEGYYSGAAY 131
             .|.|.:.:...:::||||    :...|.|..|.:...||....:.:.|.   :.|.. |:..::
  Rat    57 -FCSGVLVHPQWVLSAAHC----IQDSYTVGLGLHNLEGSQEPGSRMLEAHLSIQHPN-YNDPSF 115

  Fly   132 NNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNE 196
            .||:.::.::..:..:| ||:.|.:|.:.|..|....|||||....|...| .|..|::.:.|.|
  Rat   116 ANDLMLIKLNESVMESN-TIRRIPVASQCPTPGDTCLVSGWGRLKNGKLPS-LLQCVNLSVASEE 178

  Fly   197 LCDQDYEDFGDETYRITSAMLCAGKRGVGG---ADACQGDSGGPLAVRDELYGVVSWG-NSCALP 257
            .|...|    |..|.:  :|.|||    ||   .|.|.||||||:.....|.|:||.| ..|..|
  Rat   179 TCRLLY----DPVYHL--SMFCAG----GGPDRKDTCNGDSGGPIVCNRSLQGLVSMGQGECGQP 233

  Fly   258 NYPGVYANVAYLRPWI 273
            ..|.||.|:.....||
  Rat   234 GIPSVYTNLCKFTNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 71/241 (29%)
Tryp_SPc 39..276 CDD:238113 72/242 (30%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 69/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.