DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG10587

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:291 Identity:93/291 - (31%)
Similarity:147/291 - (50%) Gaps:38/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLLAF------LVSLVALTQGLPLLEDLDE--KSVP----DGRIVGGYATDIAQV-PYQISLRYK 59
            |||.:      |.|:..|.|.|....|:::  |.|.    ..|:|||..|..||: .|.|:|||:
  Fly     3 GLLLYCLLTAPLASIEVLAQDLNQTIDVNKLAKIVQRPGFQTRVVGGDVTTNAQLGGYLIALRYE 67

  Fly    60 GITTPENPFRHRCGGSIFNETTIVTAAHCVIGTV-ASQYKVVAGTNFQTGSDGVITNVKEIVMHE 123
                    ....|||::.::..::|||||.:|.| .|.:..|.|.: :....|:...|||:: ..
  Fly    68 --------MNFVCGGTLLHDLIVLTAAHCFLGRVKISDWLAVGGAS-KLNDRGIQRQVKEVI-KS 122

  Fly   124 GYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLL-A 187
            ..:.....|.|:|||.:..  |:...::..:.|..:|.:.||..:|||||.|....:...:|| .
  Fly   123 AEFREDDMNMDVAILRLKK--PMKGKSLGQLILCKKQLMPGTELRVSGWGLTENSEFGPQKLLRT 185

  Fly   188 VDVPIVSNELCDQDYEDFGDETYR---------ITSAMLCAGKRGVGGADACQGDSGGPLAVRDE 243
            |.||:|..:.|...|.....|:::         :|.:|.|||.  :|..|||..||||||..:::
  Fly   186 VTVPVVDKKKCRASYLPTDWESHKHFDLFLKVHLTDSMFCAGV--LGKKDACTFDSGGPLVYKNQ 248

  Fly   244 LYGVVSWGNSCALPNYPGVYANVAYLRPWID 274
            :.|:||:|..||...|.|||.::.|::|:|:
  Fly   249 VCGIVSFGIGCASKRYYGVYTDIMYVKPFIE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 81/246 (33%)
Tryp_SPc 39..276 CDD:238113 81/248 (33%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 81/246 (33%)
Tryp_SPc 46..280 CDD:238113 81/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.