DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG7542

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:285 Identity:74/285 - (25%)
Similarity:120/285 - (42%) Gaps:49/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGG 74
            |...|.||.....:|||.|::.      .|..|...::.|.|||     .|:......:...|||
  Fly     4 LLVCVLLVGSCTAVPLLTDVEP------YITNGEPAEVGQFPYQ-----AGLNVSFGNWSTWCGG 57

  Fly    75 SIFNETTIVTAAHCVIGTVASQYKVVA---GTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIA 136
            ::.:...|:|||||:.|..:....:.|   |...:.|.:.::.....|::|..|.:.... |||:
  Fly    58 TLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVV-NDIS 121

  Fly   137 IL----FVDPPLPLNNFTIKAIKLALEQPIEG---TVSKV----SGWGTTSPGGYSSNQLLA-VD 189
            ::    ||       .||.:....:|.:.:.|   |...:    ||||..|....|.:.:|. |:
  Fly   122 LIRLPAFV-------GFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVE 179

  Fly   190 VPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVR----DELYGVVSW 250
            :||:.:.||...:..      .::..|:|...  ..|...|.|||||||..:    ..|.|..|:
  Fly   180 MPIMPHSLCRMYWSG------AVSEKMICMST--TSGKSTCHGDSGGPLVYKQGNSSYLIGSTSF 236

  Fly   251 GNS--CALPNYPGVYANVAYLRPWI 273
            |.|  |.: .:|.|:..::....||
  Fly   237 GTSMGCQV-GFPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 64/255 (25%)
Tryp_SPc 39..276 CDD:238113 66/256 (26%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 66/256 (26%)
Tryp_SPc 27..260 CDD:214473 64/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.