DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG4914

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:257 Identity:94/257 - (36%)
Similarity:132/257 - (51%) Gaps:40/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVV 100
            :.|||||..|.:::.|:...|.|..        |..|||::.|:..::||||||.|.:....||.
  Fly   125 ESRIVGGTTTGVSEYPWMARLSYFN--------RFYCGGTLINDRYVLTAAHCVKGFMWFMIKVT 181

  Fly   101 AGTNFQTGSDGVITNVKE-------IVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKL-A 157
            .|.:.:       .|.||       :......:|.:.::||||:|.::..:|:.:| |:.|.| .
  Fly   182 FGEHDR-------CNDKERPETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSF-IRPICLPR 238

  Fly   158 LEQPIE---GTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELC--DQDYEDFGDETYRITSAML 217
            :||..:   ||.:..:||||....|..|..|..|:||::.|:.|  ..:|..     ..||..|:
  Fly   239 VEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQ-----KMITKNMM 298

  Fly   218 CAGKRGVGGADACQGDSGGPLA------VRDELYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            |:|..||||.|:|||||||||.      .|.|..|:|||||.||.|||||||..|.....||
  Fly   299 CSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 92/253 (36%)
Tryp_SPc 39..276 CDD:238113 93/254 (37%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 92/253 (36%)
Tryp_SPc 128..363 CDD:238113 93/254 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.