DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG10663

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:115/268 - (42%) Gaps:62/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHR-CGGSIFNETTIVTAAHCV-------IGTVA 94
            :|:||.|....:.|:|:::.        |.|:.. |||::.....::||||||       ||.  
  Fly   506 KIIGGRAARKGEWPWQVAIL--------NRFKEAFCGGTLIAPRWVLTAAHCVRKVLFVRIGE-- 560

  Fly    95 SQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKL--- 156
                  ...|::.|:: :...|.:...|.. :.....::|:|:|    .||      ||:..   
  Fly   561 ------HNLNYEDGTE-IQLRVMKSYTHPN-FDKRTVDSDVALL----RLP------KAVNATTW 607

  Fly   157 ----ALEQPIEGTVSKVS----GWGTTSPGGYSSNQLL-AVDVPIVSNELCDQDYEDFGDETYRI 212
                .|.||.:.....|.    |||.......:...:| ...|||:..:.|.:.|.|     |.|
  Fly   608 IGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYD-----YTI 667

  Fly   213 TSAMLCAGKRGVGGADACQGDSGGPLAVRD--------ELYGVVSWGNSCALPNYPGVYANVAYL 269
            |..|.|||.: .|..|.|.|||||||..||        .::|:.|:|:.||..|..|:||.|...
  Fly   668 TKNMFCAGHQ-KGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNY 731

  Fly   270 RPWIDAVL 277
            ..|:.:|:
  Fly   732 VDWVWSVV 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 73/262 (28%)
Tryp_SPc 39..276 CDD:238113 74/264 (28%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 73/262 (28%)
Tryp_SPc 507..735 CDD:238113 73/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.