DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG33465

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:295 Identity:75/295 - (25%)
Similarity:114/295 - (38%) Gaps:76/295 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVSLVALTQGLPLLEDL---DEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGG 74
            |:.|| |.|||..|.|.   |.|:..:.....| ||:.|  |:..|: ||     .|.|  .|.|
  Fly     9 LIGLV-LCQGLAQLLDKKCHDPKTSENINFNHG-ATETA--PWMASI-YK-----NNQF--ICDG 61

  Fly    75 SIFNETTIVTAAHCVIGTVASQYKVVAG------------TNFQTGSDGVITNVKEIVMHEGYYS 127
            ::.::..::|||.|:  :..||..|:.|            .|.|.|       |...:.|..:..
  Fly    62 TLVHKLFVLTAASCI--SKDSQLYVLFGMYNQYRDASQFFNNEQYG-------VAVALQHSNFRP 117

  Fly   128 GAAYNNDIAILFVDPPLPLNNFT----IKAIKLALEQPIEGT-VSKVSGWGTTSPGGYSSNQL-- 185
            .... |||.:|.:     ....|    |:.|.:.|:..::.. ..:..|:|....|..:|:|:  
  Fly   118 NNGV-NDIGLLRL-----YGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQ 176

  Fly   186 ---LAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGV 247
               |:...|..    |.::     .:...|.....|||.|   ....|:.:||.||.. |..|||
  Fly   177 TVYLSQKKPFE----CHRN-----GQLLPINEGQFCAGNR---DRSFCRSNSGSPLTA-DFTYGV 228

  Fly   248 ---------VSWGNSCALPNYPGVYANVAYLRPWI 273
                     ||:|:....|.  .||.:|...:.||
  Fly   229 KNITVQVGLVSYGSELCSPT--SVYTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 62/265 (23%)
Tryp_SPc 39..276 CDD:238113 64/266 (24%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 60/254 (24%)
Tryp_SPc 46..261 CDD:214473 58/252 (23%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.