DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG16998

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:248 Identity:81/248 - (32%)
Similarity:114/248 - (45%) Gaps:27/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKV 99
            |..|||||....|...|:..|:...|        .:.|..::.....:|||.|||  .....|.|
  Fly    21 PQERIVGGVEVPIHLTPWLASITVHG--------NYSCSSALITSLWLVTAGHCV--QYPDSYSV 75

  Fly   100 VAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEG 164
            .||:.|..|. |...||..:::|.. ::.....||||:|.:|....|.. .|:.:||.|  |...
  Fly    76 RAGSTFTDGG-GQRRNVVSVILHPD-FNLRTLENDIALLKLDKSFTLGG-NIQVVKLPL--PSLN 135

  Fly   165 TVSK---VSGWGT-TSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYR-ITSAMLCAGKRGV 224
            .:.:   |:|||. .:....|..:|....|.:::..||.:.|    ...:| ||..|:||..   
  Fly   136 ILPRTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLY----SHLHRPITDDMVCAAG--- 193

  Fly   225 GGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAYLRPWIDAVL 277
            .|.|.|.||||.||..|...||:||:.:.||.|::||||..:|....||..||
  Fly   194 AGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNVL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 76/239 (32%)
Tryp_SPc 39..276 CDD:238113 77/241 (32%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 76/239 (32%)
Tryp_SPc 25..242 CDD:238113 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.