DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and KLKB1

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:249 Identity:93/249 - (37%)
Similarity:131/249 - (52%) Gaps:30/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIG-TVASQYKVVA 101
            |||||..:...:.|:|:||:.| :|..    ||.||||:.....::|||||..| .:...:::.:
Human   401 RIVGGTNSSWGEWPWQVSLQVK-LTAQ----RHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYS 460

  Fly   102 G-TNF-QTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEG 164
            | .|. ....|...:.:|||::|:.|..... |:|||::.:..||....|. |.|.|    |.:|
Human   461 GILNLSDITKDTPFSQIKEIIIHQNYKVSEG-NHDIALIKLQAPLNYTEFQ-KPICL----PSKG 519

  Fly   165 TVSK------VSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRG 223
            ..|.      |:|||.:...|...|.|..|::|:|:||.|.:.|:|     |:||..|:|||.: 
Human   520 DTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQD-----YKITQRMVCAGYK- 578

  Fly   224 VGGADACQGDSGGPLAVRD----ELYGVVSWGNSCALPNYPGVYANVAYLRPWI 273
            .||.|||:|||||||..:.    .|.|:.|||..||....||||..||....||
Human   579 EGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWI 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 91/247 (37%)
Tryp_SPc 39..276 CDD:238113 92/248 (37%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 401..632 CDD:214473 91/247 (37%)
Tryp_SPc 402..632 CDD:238113 90/246 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.