DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG9897

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:286 Identity:83/286 - (29%)
Similarity:129/286 - (45%) Gaps:54/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIF 77
            |:.:||    ||.|      ::.|.||:.|...:|...|:..|:....        :.:|||:|.
  Fly     7 LLQIVA----LPWL------ALGDQRIINGNTVNIKDAPWYASIIVNS--------KLKCGGAII 53

  Fly    78 NETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDP 142
            ::..|:|||.||.|..|...:|..||: ..|:.|.|..:.::.:| ..||...::|::|:|   .
  Fly    54 SKNYILTAAKCVDGYSARSIQVRLGTS-SCGTSGSIAGICKVKVH-SQYSSWRFDNNLALL---K 113

  Fly   143 PLPLNNFT--IKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQL-LAVDVPIVS--NELCDQDY 202
            ...|.|.|  ||.|:.|.:.|.:.:.:.|:|.     ||.|.|.| |.:|:.|.|  .|.|.|..
  Fly   114 TCELLNTTDEIKPIERADKVPDDNSRANVTGC-----GGRSGNFLDLILDLRISSGIEEKCFQLP 173

  Fly   203 EDFGDETYRITSAMLCAGK---------RGVG---------GADACQGDSGGPLAVRDELYGVVS 249
            ........||.|...||..         :|:.         |..||..|.|.||.:.::|.|::|
  Fly   174 VQLHGTQVRILSQKQCAADWKVIPFYLLKGISDLTICTKSPGKGACSTDRGSPLVIDNKLVGILS 238

  Fly   250 WGNSCALPNYPGVYANVAYLRPWIDA 275
            .. .|::.  |.||||:.....|:|:
  Fly   239 RA-GCSIK--PDVYANILGHTNWLDS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 74/257 (29%)
Tryp_SPc 39..276 CDD:238113 75/260 (29%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 74/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.