DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG32833

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:285 Identity:72/285 - (25%)
Similarity:116/285 - (40%) Gaps:53/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LTQGLPLL--------------EDLDEKSVPD--GRIVGGYATDIAQVPY--QISLRYKGITTPE 65
            |.:.||:.              ||.:|....|  ...:||:..:|...|:  .||::.|.     
  Fly     2 LLRSLPIFLALFVLSKSDTGAGEDSEEDDENDCNRTTLGGHPVNITTAPWIASISIKQKA----- 61

  Fly    66 NPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVI-TNVKEIVMHEGYYSGA 129
                 :|.|:|:..:.||||..||.|.:....:|..|:.  |.||||| ..|..|.:||.:....
  Fly    62 -----KCDGAIYKLSHIVTAGKCVDGFLNKVIRVRVGST--TRSDGVIEVAVCNITVHEKFTGQT 119

  Fly   130 AYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGT-----------TSPGGYSSN 183
            .::| :|||.:..||..:. ||:.|:||.:.|..|.....:||.:           .....|   
  Fly   120 VFHN-VAILKLCEPLEASK-TIQPIQLANQLPSNGAKVTANGWPSFRWWAMYWKKCLDDEAY--- 179

  Fly   184 QLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVV 248
            :|...:|.::....|...:..........|..:.|..|   ...:||....|.|:....:|.|::
  Fly   180 KLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCTEK---FAKEACSLAMGSPVVHNGKLVGII 241

  Fly   249 SWGNSCALPNYPGVYANVAYLRPWI 273
            :.| .|:  .||.||.|:...:.|:
  Fly   242 TKG-GCS--EYPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 64/248 (26%)
Tryp_SPc 39..276 CDD:238113 65/249 (26%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 65/247 (26%)
Tryp_SPc 40..262 CDD:214473 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.