DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and iotaTry

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:267 Identity:100/267 - (37%)
Similarity:130/267 - (48%) Gaps:36/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNET 80
            :||....|.||.|..:... .|||:||....|...|:|:|::...        ||.|||.|:::.
  Fly     6 IVATVLVLLLLGDASDVEA-TGRIIGGSDQLIRNAPWQVSIQISA--------RHECGGVIYSKE 61

  Fly    81 TIVTAAHCVIGTVASQYKV-VAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPL 144
            .|:||.||:.....:..|| |...|...|  |.:..|....:|| .:.....:.|||:|.:..||
  Fly    62 IIITAGHCLHERSVTLMKVRVGAQNHNYG--GTLVPVAAYKVHE-QFDSRFLHYDIAVLRLSTPL 123

  Fly   145 PLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSN----QLLAVDVPIVSNELCDQDY--- 202
            .. ..:.:||.||...|..||...|:|||.|..|..|.:    ||..:|    ..|...|.:   
  Fly   124 TF-GLSTRAINLASTSPSGGTTVTVTGWGHTDNGALSDSLQKAQLQIID----RGECASQKFGYG 183

  Fly   203 EDF-GDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANV 266
            .|| |:||       :||...   .||||.|||||||....:|.|:||||..||..|||||||:|
  Fly   184 ADFVGEET-------ICAAST---DADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADV 238

  Fly   267 AYLRPWI 273
            |.|||||
  Fly   239 AILRPWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 91/243 (37%)
Tryp_SPc 39..276 CDD:238113 92/244 (38%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 91/243 (37%)
Tryp_SPc 28..247 CDD:238113 92/244 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443236
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.