DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and etaTry

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:272 Identity:122/272 - (44%)
Similarity:166/272 - (61%) Gaps:26/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IVGLLA--FLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPF 68
            |:.:||  ||:.:.|::            :..|||||||..|......|.:.||.:  ::..:.:
  Fly     5 ILRILAVLFLLGIYAVS------------AQSDGRIVGGADTSSYYTKYVVQLRRR--SSSSSSY 55

  Fly    69 RHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNN 133
            ...|||.|.:..||.||||||....|..:.||||.:.:.|.:||:..|.:::.|| .|:.:..:|
  Fly    56 AQTCGGCILDAVTIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHE-LYNSSTMDN 119

  Fly   134 DIAILFVDPPLPLNNF-TIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNEL 197
            |||::.|||||||::| |::||::|.|||..|..:.:||||.|...|.||:||..|.||||.:|.
  Fly   120 DIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEK 184

  Fly   198 CDQDYEDFGDETYR-ITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPG 261
            |.:.|      .:| |:..||||| ...||.|||||||||||.|.::|.|:||||..||.|||||
  Fly   185 CQEAY------YWRPISEGMLCAG-LSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPG 242

  Fly   262 VYANVAYLRPWI 273
            |||||||.:.||
  Fly   243 VYANVAYYKDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 112/236 (47%)
Tryp_SPc 39..276 CDD:238113 113/237 (48%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 112/236 (47%)
Tryp_SPc 28..257 CDD:238113 113/237 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.