DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and PRSS41

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:278 Identity:81/278 - (29%)
Similarity:119/278 - (42%) Gaps:73/278 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCV-------------- 89
            :.||..:...:.|:|.|||.:.        |||||||:.:...:::||||.              
Human    71 VAGGVESARGRWPWQASLRLRR--------RHRCGGSLLSRRWVLSAAHCFQKHYYPSEWTVQLG 127

  Fly    90 ----------IGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPL 144
                      :...:|:|||          ..:|.|...:         ....||||:|.:...:
Human   128 ELTSRPTPWNLRAYSSRYKV----------QDIIVNPDAL---------GVLRNDIALLRLASSV 173

  Fly   145 PLNNFTIKAIKLALEQPIEGTVSK----VSGWGTTSPGG------YSSNQLLAVDVPIVSNELCD 199
            ..|.: |:.|  .:|......|.:    |:|||..||.|      |:   |....|.|::|..|:
Human   174 TYNAY-IQPI--CIESSTFNFVHRPDCWVTGWGLISPSGTPLPPPYN---LREAQVTILNNTRCN 232

  Fly   200 QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAV-RDELY---GVVSWGNSCALPNYP 260
            ..:|.....: .|..:|.|||... |..|.|:|||||||.. :|.|:   |:||||..|..||.|
Human   233 YLFEQPSSRS-MIWDSMFCAGAED-GSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQPNRP 295

  Fly   261 GVYANVAYLRPWIDAVLA 278
            |||.|::....||..|::
Human   296 GVYTNISVYFHWIRRVMS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 78/271 (29%)
Tryp_SPc 39..276 CDD:238113 80/274 (29%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.