DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG13744

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:280 Identity:82/280 - (29%)
Similarity:119/280 - (42%) Gaps:41/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LLEDLDEKSVP-------DGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTI 82
            ||....|..||       ..||:||.....|:.|:|..:|..         .::|||.:.:...:
  Fly   121 LLNPKPECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRIA---------EYQCGGVLISANMV 176

  Fly    83 VTAAHCVIGTVASQYKVVAGTNFQTGSDGVI--------TNVKEIVMHEGYYSGAAYNN--DIAI 137
            .|||||:.....:...|..| ...|...|.|        ..|.:.::|..:.......:  |||:
  Fly   177 ATAAHCIQQAHLADITVYLG-ELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIAL 240

  Fly   138 LFVDPPLPLNNFTIKAIKLALEQ-PIE--GTVSKVSGWGTTSP--GGYSSNQLLAVDVPIVSNEL 197
            |.:..|   .:||...:.:.|.| ||.  |....::|||.|..  |...:|.|....|||::...
  Fly   241 LKLAQP---TSFTEHILPICLPQYPIRLIGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLD 302

  Fly   198 CDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE----LYGVVSWGNSCALPN 258
            |.:.:|. ......|.:.|.||| ...|..|||.|||||||.:::.    |.|:.|.|..|.:.:
  Fly   303 CIRWHES-KQINVEIKAEMFCAG-HSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDH 365

  Fly   259 YPGVYANVAYLRPWIDAVLA 278
            .||:|.||.....||..|:|
  Fly   366 QPGIYHNVQKTVRWIQEVVA 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 73/253 (29%)
Tryp_SPc 39..276 CDD:238113 74/255 (29%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 73/253 (29%)
Tryp_SPc 142..383 CDD:238113 74/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.