DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and KLK3

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:289 Identity:85/289 - (29%)
Similarity:133/289 - (46%) Gaps:46/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFR 69
            |:.  :.||...|......||:.         .|||||:..:....|:|:.:..:|        |
Human     2 WVP--VVFLTLSVTWIGAAPLIL---------SRIVGGWECEKHSQPWQVLVASRG--------R 47

  Fly    70 HRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTN--FQTGSDGVITNVKEIVMHEGY------- 125
            ..|||.:.:...::|||||    :.::..::.|.:  |.....|.:..|.....|..|       
Human    48 AVCGGVLVHPQWVLTAAHC----IRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKN 108

  Fly   126 ---YSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGY-SSNQLL 186
               ..|...::|:.:|.:..|..|.: .:|.:.|..::|..||....||||:..|..: :..:|.
Human   109 RFLRPGDDSSHDLMLLRLSEPAELTD-AVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQ 172

  Fly   187 AVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWG 251
            .||:.::||::|.|.:..      ::|..||||| |..||...|.|||||||.....|.|:.|||
Human   173 CVDLHVISNDVCAQVHPQ------KVTKFMLCAG-RWTGGKSTCSGDSGGPLVCNGVLQGITSWG 230

  Fly   252 NS-CALPNYPGVYANVAYLRPWI-DAVLA 278
            :. ||||..|.:|..|.:.|.|| |.::|
Human   231 SEPCALPERPSLYTKVVHYRKWIKDTIVA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 75/248 (30%)
Tryp_SPc 39..276 CDD:238113 77/251 (31%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 76/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.