DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and SPH93

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:251 Identity:74/251 - (29%)
Similarity:116/251 - (46%) Gaps:48/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGV 112
            ||.|:.:::.:.|        ::..|||:.....::|.||.|| |:.::..|.|| ::...||..
  Fly   255 AQYPWAVAIFHNG--------QYLAGGSLIQPNVVLTVAHRVI-TIETELVVRAG-DWDLKSDRE 309

  Fly   113 I-----TNVKEIVMHEG--YYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLAL-EQPIEGTVSKV 169
            |     ..|:..|:|||  :.|||   |::|:||::.|..||:. |:.|.|.. .:...|....|
  Fly   310 IFLSEQREVERAVIHEGFDFKSGA---NNLALLFLNSPFKLNDH-IRTICLPTPNKSFAGRRCTV 370

  Fly   170 SGWGTTSPGGYS----SNQLLAVDVPIVSNELCDQDYEDFGDET-----YRITSAMLCAGKRGVG 225
            :|||...   |.    |..|..|.:.:|:..:|    |.|...|     :.:...::|||  |..
  Fly   371 AGWGKMR---YEDQRYSTVLKKVQLLVVNRNVC----EKFLRSTRLGAKFELPKNIICAG--GEL 426

  Fly   226 GADACQGDSGGPL--AVRDE---LY---GVVSWGNSCALPNYPGVYANVAYLRPWI 273
            |.|.|.||.|..|  ::..|   :|   |:|:||..|.....|.:|..|:....||
  Fly   427 GRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 72/249 (29%)
Tryp_SPc 39..276 CDD:238113 74/251 (29%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 74/251 (29%)
Tryp_SPc 252..482 CDD:214473 72/249 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.