DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Send2

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:265 Identity:93/265 - (35%)
Similarity:135/265 - (50%) Gaps:52/265 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIF 77
            |::|.:|:.| |::.       |:.||:||....|.:.|:|:|::..|        :|.|||||:
  Fly     9 LLALNSLSAG-PVIR-------PEERIIGGQPIGIEEAPWQVSIQRDG--------KHLCGGSIY 57

  Fly    78 NETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDP 142
            :...|:||||||.|   ..|:|.||:..: .|:|.:.:|..|..|||      ..|||||:.:..
  Fly    58 SADIIITAAHCVQG---QGYQVRAGSALK-NSNGSVVDVAAIRTHEG------LGNDIAIVRLSK 112

  Fly   143 PLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSN--QLLAVDVPIVSNELCDQDYEDF 205
            ||...| .::.|.||...|..|:::.|||||::|   |.|:  .|..|::.|.....|.      
  Fly   113 PLEFTN-QVQPIPLAKTNPPPGSIAFVSGWGSSS---YYSHPIDLQGVNLYIQWPYYCG------ 167

  Fly   206 GDETYRITS-AMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWG-NSCALPNYPGVYANVAY 268
                  :|. :.:|||.   .|..||:|||||||....:|.||||.| ..|   .|..:|.:|.|
  Fly   168 ------LTEPSRICAGS---FGRAACKGDSGGPLVFDQQLVGVVSGGTKDC---TYSSIYTSVPY 220

  Fly   269 LRPWI 273
            .|.||
  Fly   221 FREWI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 85/238 (36%)
Tryp_SPc 39..276 CDD:238113 86/239 (36%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 85/238 (36%)
Tryp_SPc 27..225 CDD:238113 84/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.