DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and PRSS48

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:299 Identity:97/299 - (32%)
Similarity:138/299 - (46%) Gaps:63/299 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GLLAFLVSL--VALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRH 70
            |||.|.:||  ::|..|.|         |...|:|||......:.|:|:||.          |.|
Human    27 GLLGFHISLSSLSLVCGQP---------VYSSRVVGGQDAAAGRWPWQVSLH----------FDH 72

  Fly    71 R--CGGSIFNETTIVTAAHCVIGT-VASQYKVVAGTNFQTGSDG---VITNVKEIVMHEGYYSGA 129
            .  ||||:.:|..|:|||||:..| ....|.|..|:  .|..|.   |...|.:||:|..|....
Human    73 NFICGGSLVSERLILTAAHCIQPTWTTFSYTVWLGS--ITVGDSRKRVKYYVSKIVIHPKYQDTT 135

  Fly   130 AYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSK---------VSGWG---TTSPGGYSS 182
            |   |:|:|.:...:   .||...:.:.|.     :|:|         |:|||   .:|...|.|
Human   136 A---DVALLKLSSQV---TFTSAILPICLP-----SVTKQLAIPPFCWVTGWGKVKESSDRDYHS 189

  Fly   183 NQLLAVDVPIVSNELCDQDYEDFGDETYRITSAM----LCAGKRGVGGADACQGDSGGPLAVR-D 242
             .|...:|||:..:.|:|.|...|.....:...:    :|||.. ....|:|:|||||||:.. |
Human   190 -ALQEAEVPIIDRQACEQLYNPIGIFLPALEPVIKEDKICAGDT-QNMKDSCKGDSGGPLSCHID 252

  Fly   243 ELY---GVVSWGNSCALPNYPGVYANVAYLRPWIDAVLA 278
            .::   ||||||..|. .:.||||.||.|.:.||:|.::
Human   253 GVWIQTGVVSWGLECG-KSLPGVYTNVIYYQKWINATIS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 84/260 (32%)
Tryp_SPc 39..276 CDD:238113 85/262 (32%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 84/260 (32%)
Tryp_SPc 51..288 CDD:238113 85/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.