DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and TMPRSS7

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:282 Identity:90/282 - (31%)
Similarity:125/282 - (44%) Gaps:61/282 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PDG----------------RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIV 83
            |||                ||:||..|.....|:|:||.:.|..        .||.|:.:...::
Human   586 PDGSDEEGCTCSRSSSALHRIIGGTDTLEGGWPWQVSLHFVGSA--------YCGASVISREWLL 642

  Fly    84 TAAHCVIGTVASQ---YKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLP 145
            :||||..|...|.   :....|...| |:...::.|:.||:|| ||:...::.|||:|.:....|
Human   643 SAAHCFHGNRLSDPTPWTAHLGMYVQ-GNAKFVSPVRRIVVHE-YYNSQTFDYDIALLQLSIAWP 705

  Fly   146 LNNFTIKAIKLALEQPI----------EGTVSKVSGWGTTSPGGYSSNQLL-AVDVPIVSNELCD 199
               .|:|    .|.|||          .|....|:|||.........:.:| ..:|.::...||.
Human   706 ---ETLK----QLIQPICIPPTGQRVRSGEKCWVTGWGRRHEADNKGSLVLQQAEVELIDQTLCV 763

  Fly   200 QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE------LYGVVSWGNSCALPN 258
            ..|.       .|||.|||||... |..|||:|||||||:.|.:      |.|:||||:....||
Human   764 STYG-------IITSRMLCAGIMS-GKRDACKGDSGGPLSCRRKSDGKWILTGIVSWGHGSGRPN 820

  Fly   259 YPGVYANVAYLRPWIDAVLAGL 280
            :||||..|:...|||...:..|
Human   821 FPGVYTRVSNFVPWIHKYVPSL 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 84/254 (33%)
Tryp_SPc 39..276 CDD:238113 85/256 (33%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.