DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Try29F

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:288 Identity:112/288 - (38%)
Similarity:147/288 - (51%) Gaps:36/288 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSWIVGLLAFLVSLVALTQGLPLLEDLD-----EKSVPDGRIVGGYATDIAQVPYQISLRYKG 60
            |.||  :||.....:::.|..|..||.:|.     .:...|||||||...:|..:|||:||:.. 
  Fly     1 MRSS--IGLTGMAKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRS- 62

  Fly    61 ITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGY 125
                    .|.||||:..:..::|||||..|:.....||..|:: :|...|.:..:|.:..|..:
  Fly    63 --------YHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSS-RTSVGGQLVGIKRVHRHPKF 118

  Fly   126 YSGAAYNNDIAILFVDPPLPLNNFTIKAIKLAL----EQP---IEGTVSKVSGWGTTSPGGYSSN 183
               .||..|    |....|.|..::.|.:..|.    ||.   .:||...|||||.|.....:|.
  Fly   119 ---DAYTID----FDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSA 176

  Fly   184 QLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVV 248
            .|.:|.||.||...|.:.|.:||.    ||..||||| ...||.||||||||||||....|:|||
  Fly   177 VLRSVTVPKVSQTQCTEAYGNFGS----ITDRMLCAG-LPEGGKDACQGDSGGPLAADGVLWGVV 236

  Fly   249 SWGNSCALPNYPGVYANVAYLRPWIDAV 276
            |||..||.|||||||:.|:.:|.||.:|
  Fly   237 SWGYGCARPNYPGVYSRVSAVRDWISSV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 97/241 (40%)
Tryp_SPc 39..276 CDD:238113 98/243 (40%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 97/241 (40%)
Tryp_SPc 42..264 CDD:238113 98/243 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443320
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.