DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and OVCH2

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:259 Identity:75/259 - (28%)
Similarity:116/259 - (44%) Gaps:38/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIG-TVASQYKVVA 101
            ||:||...:....|:|:||:.:.        :|.|||||.:...::|||||:.. .:.|...|.|
Human    55 RILGGSQVEKGSYPWQVSLKQRQ--------KHICGGSIVSPQWVITAAHCIANRNIVSTLNVTA 111

  Fly   102 GTN--FQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIE- 163
            |..  .||........::.:::|..:.:....:.|||:|.:.......:|........|.:..| 
Human   112 GEYDLSQTDPGEQTLTIETVIIHPHFSTKKPMDYDIALLKMAGAFQFGHFVGPICLPELREQFEA 176

  Fly   164 GTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDY----EDFGDETYRITSAMLCAGKRGV 224
            |.:...:|||..:.||..|..|..|::||::.|.|....    .....:|:      ||.|... 
Human   177 GFICTTAGWGRLTEGGVLSQVLQEVNLPILTWEECVAALLTLKRPISGKTF------LCTGFPD- 234

  Fly   225 GGADACQGDSGGPLAVRDE-----LYGVVSWGNSCAL----------PNYPGVYANVAYLRPWI 273
            ||.|||||||||.|..|::     |.||.|||..|..          ...||::.:::.:.|||
Human   235 GGRDACQGDSGGSLMCRNKKGAWTLAGVTSWGLGCGRGWRNNVRKSDQGSPGIFTDISKVLPWI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 73/257 (28%)
Tryp_SPc 39..276 CDD:238113 74/258 (29%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 73/257 (28%)
Tryp_SPc 56..301 CDD:238113 74/258 (29%)
CUB 320..424 CDD:238001
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.