DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and PRSS38

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:264 Identity:84/264 - (31%)
Similarity:120/264 - (45%) Gaps:58/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHC------------ 88
            :|:|:||......:.|:|:|:.|.|:        |.|||||.||..:::||||            
Human    57 EGKILGGVPAPERKWPWQVSVHYAGL--------HVCGGSILNEYWVLSAAHCFHRDKNIKIYDM 113

  Fly    89 VIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIA-------ILFVDPPLPL 146
            .:|.|..:   |||.:.|.      ..|..:::|..|........|:|       |:|.:..|| 
Human   114 YVGLVNLR---VAGNHTQW------YEVNRVILHPTYEMYHPIGGDVALVQLKTRIVFSESVLP- 168

  Fly   147 NNFTIKAIKLALEQPIEGTVSK---VSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDE 208
                     :.|..|.....|.   .:|||..|..|.:|::|..:.:|::....|...|   |..
Human   169 ---------VCLATPEVNLTSANCWATGWGLVSKQGETSDELQEMQLPLILEPWCHLLY---GHM 221

  Fly   209 TYRITSAMLCAGKRGVGGADACQGDSGGPLAV---RDEL-YGVVSWGNSCALPNYPGVYANVAYL 269
            :| |...|||||.. :.....|:|||||||..   |..| .|:||||..|:.|.||||||:|:|.
Human   222 SY-IMPDMLCAGDI-LNAKTVCEGDSGGPLVCEFNRSWLQIGIVSWGRGCSNPLYPGVYASVSYF 284

  Fly   270 RPWI 273
            ..||
Human   285 SKWI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 81/260 (31%)
Tryp_SPc 39..276 CDD:238113 83/261 (32%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 83/261 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.