DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and PRSS53

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:358 Identity:84/358 - (23%)
Similarity:126/358 - (35%) Gaps:122/358 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIVGLLAFLVSLVALTQGLPLLEDLDEKSVP------DGRIVGGYATDIAQVPYQISLRYKGITT 63
            |..|.:..:.....|.:||...:....:..|      :|..|.|      :.|:|.|:|.:|   
Human     3 WCWGPVLLIAGATVLMEGLQAAQRACGQRGPGPPKPQEGNTVPG------EWPWQASVRRQG--- 58

  Fly    64 PENPFRHRCGGSIFNETTIVTAAHC---VIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGY 125
                 .|.|.||:..:|.::|||||   ...|..:.:.||.|:                :..||.
Human    59 -----AHICSGSLVADTWVLTAAHCFEKAAATELNSWSVVLGS----------------LQREGL 102

  Fly   126 YSGA------------AYN-----NDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWG 173
            ..||            |||     :|:|:|.:..|       .....|.|.||........|.|.
Human   103 SPGAEEVGVAALQLPRAYNHYSQGSDLALLQLAHP-------TTHTPLCLPQPAHRFPFGASCWA 160

  Fly   174 T-----TSPG-------------------------GYSS-----NQLLA--------------VD 189
            |     ||.|                         |:.|     :|.||              :.
Human   161 TGWDQDTSDGKCWPRLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLR 225

  Fly   190 VPIVSNELCDQDYEDFGDE--TYRITSAMLCAGKR-GVGGADACQGDSGGP-LAVRDELY----G 246
            :.::|...|:..|......  :......|||.|.: ||.|  .|||||||| |.:..:.:    |
Human   226 LRLISRPTCNCIYNQLHQRHLSNPARPGMLCGGPQPGVQG--PCQGDSGGPVLCLEPDGHWVQAG 288

  Fly   247 VVSWGNSCALPNYPGVYANVAYLRPWIDAVLAG 279
            ::|:.:|||..:.|.:..|.|....|:.|.:.|
Human   289 IISFASSCAQEDAPVLLTNTAAHSSWLQARVQG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 74/311 (24%)
Tryp_SPc 39..276 CDD:238113 75/313 (24%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 75/312 (24%)
Tryp_SPc 43..314 CDD:214473 74/309 (24%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.