DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG4271

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:208 Identity:62/208 - (29%)
Similarity:99/208 - (47%) Gaps:20/208 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGT-NFQTGSDGVITNVKEIVMHEGYYSGAAYNN 133
            |.|||::.:...::|||.||......:..|..|| :...|  |.|..|..:|:||.|.:   ::|
  Fly    42 HECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRG--GRIIRVTALVVHENYKN---WDN 101

  Fly   134 DIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDV-PIVSNEL 197
            |||:|:::.  |:.:..:..|.||.::|.|......:|||......|...:.|...| .|....:
  Fly   102 DIALLWLEK--PVLSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSM 164

  Fly   198 CDQD-YEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPG 261
            |.:: .|..|:|       :|||   .....|.|.||.||||.:.:::.|:...|:.|.....|.
  Fly   165 CAEELVEPVGEE-------LLCA---FYTENDICPGDYGGPLVLANKVVGIAVQGHGCGFAVLPS 219

  Fly   262 VYANVAYLRPWID 274
            :|.||.:...||:
  Fly   220 LYTNVFHYLEWIE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 60/205 (29%)
Tryp_SPc 39..276 CDD:238113 62/208 (30%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 62/208 (30%)
Tryp_SPc 19..231 CDD:214473 60/205 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.