DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG1304

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:276 Identity:87/276 - (31%)
Similarity:127/276 - (46%) Gaps:42/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AFLVSLVALTQGLPLLEDLDEKSVP---DGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRC 72
            |.|:....|...:|:      .|.|   :||:|||......|.|:|:|||..|        .|.|
  Fly     7 AILLGSFLLLLAVPV------HSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAG--------SHSC 57

  Fly    73 GGSIFNETTIVTAAHCV---------IGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSG 128
            ||||.:...::||||||         :...|.::.:.||:| ...|.||:..|.|:::||.|   
  Fly    58 GGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSN-DRFSGGVLVQVAEVIVHEEY--- 118

  Fly   129 AAYNNDIAILFVDPPLPLNNFTIKAIKL-ALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPI 192
            ..:.||:|:|.::.||.| :.:|:.|.| ..:.|.:..|. :||||.....|.....|....:..
  Fly   119 GNFLNDVALLRLESPLIL-SASIQPIDLPTADTPADVDVI-ISGWGRIKHQGDLPRYLQYNTLKS 181

  Fly   193 VSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALP 257
            :|.|.|| :...:|      ..:.||.......|  ||.||||||....:::.||..:..|....
  Fly   182 ISLERCD-ELIGWG------VQSELCLIHEADNG--ACNGDSGGPAVYNNQVVGVAGFVWSACGT 237

  Fly   258 NYPGVYANVAYLRPWI 273
            :||..||.|.|...||
  Fly   238 SYPDGYARVYYHNEWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 78/244 (32%)
Tryp_SPc 39..276 CDD:238113 79/245 (32%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 78/244 (32%)
Tryp_SPc 32..256 CDD:238113 79/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.