DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Ser6

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:275 Identity:90/275 - (32%)
Similarity:128/275 - (46%) Gaps:41/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCG 73
            |.:||:.||...|..|        ...:||:|||......|.|:|:|||..|        .|.||
  Fly    10 LCSFLLFLVLPVQSAP--------GKLNGRVVGGEDAVKNQFPHQVSLRNAG--------SHSCG 58

  Fly    74 GSIFNETTIVTAAHCVIG---------TVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGA 129
            |||...|.|:||||||..         ..|.::.:.||:| ...|.||:..|.|:::||.|   .
  Fly    59 GSILTRTYILTAAHCVSNEDVNHVITPIAAERFTIRAGSN-DRFSGGVLVQVAEVIVHEEY---G 119

  Fly   130 AYNNDIAILFVDPPLPLNNFTIKAIKL-ALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIV 193
            .:.||:|:|.::.||.| :.:|:.|.| .::.|.:..| .:||||.....|.....|....:..:
  Fly   120 NFLNDVALLRLESPLIL-SASIQPIDLPTVDTPADVDV-VISGWGRIKHQGDLPRYLQYNTLKSI 182

  Fly   194 SNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPN 258
            :.:.| ::..|||.|      ..||...:...|  ||.||||||....::|.||..:........
  Fly   183 TRQQC-EELIDFGFE------GELCLLHQVDNG--ACNGDSGGPAVYNNQLVGVAGFVVDGCGST 238

  Fly   259 YPGVYANVAYLRPWI 273
            ||..||.|.|.:.||
  Fly   239 YPDGYARVFYFKDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 80/244 (33%)
Tryp_SPc 39..276 CDD:238113 81/245 (33%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 80/244 (33%)
Tryp_SPc 32..256 CDD:238113 81/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.