DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and Prss53

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:317 Identity:80/317 - (25%)
Similarity:125/317 - (39%) Gaps:89/317 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVP------DGRIVGGYATDIAQVPYQISLRYK 59
            |..||...||  :|..|.:.:||...:....:..|      :|..:.|      :.|:|.|:|.:
Mouse     1 MRQSWRPELL--IVGAVVVIEGLQAAQRACGQRGPGPPEPQEGNTLPG------EWPWQASVRRQ 57

  Fly    60 GITTPENPFRHRCGGSIFNETTIVTAAHC---VIGTVASQYKVVAGTNFQTGSDGVITNVKEIVM 121
            |:        |.|.||:..:|.::|||||   :.....|.:.||.|:                :.
Mouse    58 GV--------HICSGSLVADTWVLTAAHCFEKMATAELSSWSVVLGS----------------LK 98

  Fly   122 HEGYYSGA------------AYN-----NDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKV 169
            .||...||            |||     :|:|:|.:..|      |::. .|.|.||........
Mouse    99 QEGQSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLTHP------TVQT-TLCLPQPTYHFPFGA 156

  Fly   170 SGWGTTSPGGYSSN------QLLAVDVPIVSNELCDQDYEDFGDETYRITS-----AMLCAGKRG 223
            |.|.|    |:..|      .|..:.:.::|...|:..|.....   |:.|     .|||.|.: 
Mouse   157 SCWAT----GWDQNTSDVSRTLRNLRLRLISRPTCNCLYNRLHQ---RLLSNPARPGMLCGGAQ- 213

  Fly   224 VGGADACQGDSGGPLAVRDE-----LYGVVSWGNSCALPNYPGVYANVAYLRPWIDA 275
            .|....||||||||:..|:.     ..|::|:.:.||..:.|.:..::|....|:.|
Mouse   214 PGEQGPCQGDSGGPVMCREPDGHWVQVGIISFTSKCAQEDTPVLLTDMAVHSSWLQA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 67/270 (25%)
Tryp_SPc 39..276 CDD:238113 69/273 (25%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 2/18 (11%)
Tryp_SPc 45..271 CDD:238113 69/271 (25%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.