DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and psh

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:261 Identity:80/261 - (30%)
Similarity:119/261 - (45%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVAS--QYKVVA 101
            |||||..|....|:..::.|....|.     .|||||:.....::|||||| .|.|:  .:..:.
  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTD-----FRCGGSLIASRFVLTAAHCV-NTDANTPAFVRLG 202

  Fly   102 GTNFQ----TGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVD-PPLPLNNFTIKAIKLALEQP 161
            ..|.:    :..|.||.:||   :|. .|.|..| ||||||.:: ..:..:|.....:......|
  Fly   203 AVNIENPDHSYQDIVIRSVK---IHP-QYVGNKY-NDIAILELERDVVETDNIRPACLHTDATDP 262

  Fly   162 IEGTVSKVSGWG----TTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDE----TYRITSAMLC 218
            ...:...|:|||    ||..   .|..||...:.:|..:.|:..|.:....    ...:..::||
  Fly   263 PSNSKFFVAGWGVLNVTTRA---RSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLC 324

  Fly   219 AGKRGVGGADACQGDSGGPLA----VRDELY---GVVSWGNSCALPNYPGVYANVAYLRPWIDAV 276
            |..:.: .||||:|||||||.    |.|.:|   ||:|.|..||... ||:|..|:....:|:.:
  Fly   325 AIDQKL-IADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVT-PGLYTRVSSYLDFIEGI 387

  Fly   277 L 277
            :
  Fly   388 V 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 79/255 (31%)
Tryp_SPc 39..276 CDD:238113 80/258 (31%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 79/255 (31%)
Tryp_SPc 144..387 CDD:238113 80/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.