DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG9672

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:242 Identity:63/242 - (26%)
Similarity:104/242 - (42%) Gaps:34/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETT 81
            :.||.||.|:.....::.|.|||.||....:.|:|||.:|...|        .:.||..|..:..
  Fly     3 LTLTIGLILVAAGVLEAQPQGRIAGGEDAVLGQLPYQAALSIGG--------SYNCGAVIIGQRY 59

  Fly    82 IVTAAHCVIGT------VASQYKVVAGT-NFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILF 139
            .:||..||...      .|..:.|..|: :...|..   ..|:||.::..|   :.....||:|.
  Fly    60 ALTALSCVCSDGKDTPWAAVLFAVTVGSVDLYNGKQ---IRVEEITINPNY---STLKTGIALLR 118

  Fly   140 VDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVD-VPIVSNELCDQDYE 203
            :...:..:. |:.||.|:.:.|..|:..:|||||.|:....:.::.|.:. ..:::...|.....
  Fly   119 LQEEITFSE-TVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANR 182

  Fly   204 DFGDETYRITSAMLCAG---KRGVGGADACQGDSGGPLAVRDELYGV 247
               ||.......:||.|   ::|:     |.||.|||...:.:|.|:
  Fly   183 ---DELLVADDQVLCLGHGRRQGI-----CSGDIGGPAVYQGQLVGL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 56/221 (25%)
Tryp_SPc 39..276 CDD:238113 55/220 (25%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 56/221 (25%)
Tryp_SPc 25..250 CDD:238113 55/220 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.