DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG9676

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:274 Identity:97/274 - (35%)
Similarity:130/274 - (47%) Gaps:38/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCG 73
            :|.|..||:.|.....|.::   .||.:.|||||......|.|:|||||.:|        .|.||
  Fly     1 MLPFWTSLLVLCAAGVLAQN---DSVVEPRIVGGTKAREGQFPHQISLRRRG--------SHTCG 54

  Fly    74 GSIFNETTIVTAAHCVIG----TVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNND 134
            |||.::..:|||||||..    ..|::.::.|| :....|.||...|..:.:|..|.|.   .:|
  Fly    55 GSIISKDYVVTAAHCVKQGNNVAPANELEIQAG-SLLLSSGGVRVPVATVTVHPNYNSN---GHD 115

  Fly   135 IAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD 199
            :|:|.:...|..|: .|.|||||.|.|.......:||||..|..|..||.||.|.|..:|.|.|.
  Fly   116 VAVLRLRNSLTFNS-NIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQ 179

  Fly   200 QDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSW-----GNSCALPNY 259
            :.|.....||   |..:|....:|     ||.||||||...:.:|.|:.|:     |.:.     
  Fly   180 KTYLRQLPET---TMCLLHPKDKG-----ACYGDSGGPATYQGKLVGLASFVIGGCGRAA----- 231

  Fly   260 PGVYANVAYLRPWI 273
            |..|..|:.||.||
  Fly   232 PDGYERVSKLRNWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 87/243 (36%)
Tryp_SPc 39..276 CDD:238113 88/244 (36%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 87/243 (36%)
Tryp_SPc 28..248 CDD:238113 88/244 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.