DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and plg

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_958880.2 Gene:plg / 322691 ZFINID:ZDB-GENE-030131-1411 Length:818 Species:Danio rerio


Alignment Length:247 Identity:86/247 - (34%)
Similarity:121/247 - (48%) Gaps:30/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVA-SQYKVV 100
            ||||||..:.....|:|||||.:|..       |.|||::.:...:||||||:..:.: |.||::
Zfish   587 GRIVGGCVSKPHSWPWQISLRTRGKI-------HFCGGTLIDPQWVVTAAHCLERSDSPSAYKIM 644

  Fly   101 AG--TNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPI- 162
            .|  |...|.|.....:|.:|:      .|.| ..|||:|.:|.|..:|: .:..:.|..:..| 
Zfish   645 LGIHTERATESSKQERDVTKII------KGPA-GTDIALLKLDRPALIND-KVSPVCLPEKDYIV 701

  Fly   163 -EGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGG 226
             ..|...|:|||.|...| ....|.....|::.|::|::.....|    |:....:|||.. .||
Zfish   702 PSNTECYVTGWGETQDTG-GEGYLKETGFPVIENKVCNRPSFLNG----RVKDHEMCAGNI-EGG 760

  Fly   227 ADACQGDSGGPLAVRDE----LYGVVSWGNSCALPNYPGVYANVAYLRPWID 274
            .|:|||||||||....:    |.||.|||..||....||||..|:....||:
Zfish   761 NDSCQGDSGGPLVCYAQNTFVLQGVTSWGLGCANAMKPGVYTRVSKFVDWIE 812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 83/243 (34%)
Tryp_SPc 39..276 CDD:238113 84/245 (34%)
plgNP_958880.2 PAN_AP_HGF 31..104 CDD:238532
KR 109..190 CDD:214527
KR 190..270 CDD:214527
KR 281..361 CDD:214527
Kringle 376..453 CDD:306546
KR 490..572 CDD:214527
Tryp_SPc 589..813 CDD:238113 84/245 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.