DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG33159

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:232 Identity:79/232 - (34%)
Similarity:119/232 - (51%) Gaps:18/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAG 102
            |||||..|.|::|||.:.||..|...        ||||:.:...:::|||||.|:....:.|.||
  Fly    25 RIVGGKETTISEVPYLVYLRQNGYFI--------CGGSLISSRAVLSAAHCVYGSQPEGFTVHAG 81

  Fly   103 TNFQTGSDGVITNVKEIVMHEG-YYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTV 166
            .:.......|:.||  ::.|.. .||...::.|:|:|.:...:.|....:..|......|.....
  Fly    82 ASRLDQEAPVVRNV--VMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPPEGNAY 144

  Fly   167 SKVSGWGTTSPGGYS-SNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADAC 230
            :::||||.|...... :.|:....|.::....|...|..:|    :::.:||||..||:  .|:|
  Fly   145 ARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYG----QLSDSMLCAAVRGL--RDSC 203

  Fly   231 QGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVA 267
            .|||||||..|.::.|:||||..||.|::||||.|||
  Fly   204 SGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 79/232 (34%)
Tryp_SPc 39..276 CDD:238113 78/231 (34%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 79/232 (34%)
Tryp_SPc 26..251 CDD:238113 78/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.