DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG31267

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:280 Identity:92/280 - (32%)
Similarity:139/280 - (49%) Gaps:20/280 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSWIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENP 67
            |:.::.|||...|..:|.:.....|..:..:....|||||..:|:...||.:||        :|.
  Fly     9 STLVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSL--------QNA 65

  Fly    68 F-RHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAY 131
            : .|.|.|||.::..::|||.|:.|...:..:||..|....||:|.|.:|::||||..:.| ..|
  Fly    66 YGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDS-PMY 129

  Fly   132 NNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNE 196
            :||||::........::.|.......||...:|....:.|:|:|..||..|.||..:||..|:.|
  Fly   130 HNDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPE 194

  Fly   197 LCDQDYEDFGDETYRITSAMLCA-GKRGVGGADACQGDSGGPLA-VRDELYGVVSWGNSCALPNY 259
            .|:..|....|    :....||| ||.|.|   ||.||:|||:. .|..|.||.:||..|.. .:
  Fly   195 KCNATYGGTPD----LDVGHLCAVGKVGAG---ACHGDTGGPIVDSRGRLVGVGNWGVPCGY-GF 251

  Fly   260 PGVYANVAYLRPWIDAVLAG 279
            |.|:|.:::...||.:.:.|
  Fly   252 PDVFARISFYYSWIISTING 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 82/237 (35%)
Tryp_SPc 39..276 CDD:238113 83/239 (35%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 82/237 (35%)
Tryp_SPc 45..268 CDD:238113 83/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.