DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and CG32834

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:287 Identity:93/287 - (32%)
Similarity:131/287 - (45%) Gaps:55/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WIVGLLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFR 69
            |.|    ||..|.||.:  |:..|||.:|    ||:|||..||...|||..:...|...      
  Fly     3 WSV----FLFLLAALLR--PVRGDLDAQS----RIIGGYDVDIEDAPYQAEVIIDGTAI------ 51

  Fly    70 HRCGGSIFNETTIVTAAHCV---------IGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGY 125
              |.|:|....||:|||.||         :||.:..|.   ||.|       :..|.||:.|. .
  Fly    52 --CSGAIITSDTIITAASCVQSYGSIEVRVGTSSRDYD---GTGF-------LLEVCEIINHP-Q 103

  Fly   126 YSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGG------YSS-- 182
            |:...::|::|:|.:..||..:. .|:.|.:|.::|.:|:...|||||:||..|      :.|  
  Fly   104 YNCWRFDNNLALLKLCDPLKTSE-AIQPISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLP 167

  Fly   183 NQLLAVDVPIVSNELCDQDYED-FGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYG 246
            :.|....|.:.:.|.|..|... ||.....|:...||. ..|.||   |..|:|.||.:..:|.|
  Fly   168 DYLQMAWVSVYNREQCAADRGVWFGLWDNGISYLTLCT-HNGAGG---CSYDTGAPLVIDGQLVG 228

  Fly   247 VVSWGNSCALPNYPGVYANVAYLRPWI 273
            ::|.|.....|:   |||||.:...||
  Fly   229 ILSEGGCTTKPD---VYANVPWFTGWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 79/252 (31%)
Tryp_SPc 39..276 CDD:238113 80/253 (32%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 79/252 (31%)
Tryp_SPc 27..255 CDD:238113 80/253 (32%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.