DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and spirit

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:263 Identity:83/263 - (31%)
Similarity:134/263 - (50%) Gaps:30/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHC-- 88
            ::::||..|   .:|||..|...:.|:..:|.::  :..:....:||||::.....::|||||  
  Fly   122 VKEIDEFFV---SVVGGMPTRPREFPFMAALGWR--SNFDQRIYYRCGGALIANNFVLTAAHCAD 181

  Fly    89 VIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVD----PPLPLNNF 149
            :.|...||.: :.|.|. |.::|...:::.:::|..|.:..|| ||||:|.::    |.|     
  Fly   182 LGGEPPSQVR-LGGDNL-TLTEGEDISIRRVIIHPDYSASTAY-NDIALLELETAAKPEL----- 238

  Fly   150 TIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYR-IT 213
              |...:..::.:..|:....|:|.||..|.||.|||.|.:..||||.|...|:.  |:..: :.
  Fly   239 --KPTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQK--DQLAQGVL 299

  Fly   214 SAMLCAGKRGVGGADACQGDSGGPLAVRDEL----YGVVSWGNSCALPNYPGVYANVAYLRPWID 274
            ...:|||.. .|..|.|||||||||.::|.|    .|:.|.|..|| ...|.||..|:....||:
  Fly   300 GTQMCAGDI-TGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQGCA-SGPPSVYTRVSSFVDWIE 362

  Fly   275 AVL 277
            .::
  Fly   363 GIV 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 78/245 (32%)
Tryp_SPc 39..276 CDD:238113 80/247 (32%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 80/247 (32%)
Tryp_SPc 132..361 CDD:214473 78/244 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.